PDB entry 1zlb

View 1zlb on RCSB PDB site
Description: Crystal structure of catalytically-active phospholipase A2 in the absence of calcium
Class: hydrolase
Keywords: Asp49-PLA2, toxin, snake venom, hydrolase
Deposited on 2005-05-05, released 2006-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: N/A
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypotensive phospholipase A2
  Species: Bothrops jararacussu [TaxId:8726]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8AXY1 (0-121)
    • conflict (57)
    • conflict (78)
  Domains in SCOPe 2.08: d1zlba_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zlbA (A:)
  slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcnpk
  idsytyskkngdvvcggdnpckkqicecdrvattcfrdnkdtydikywfygakncqekse
  pc