PDB entry 1zla

View 1zla on RCSB PDB site
Description: X-ray Structure of a Kaposi's sarcoma herpesvirus LANA peptide bound to the nucleosomal core
Class: protein binding/virus/DNA
Keywords: Latency Associated Nuclear Antigen (LANA), Kaposi's sarcoma Herpes Virus (KSHV), Nucleosome core particle, chromatin, protein/protein interaction, PROTEIN BINDING/VIRUS/DNA COMPLEX
Deposited on 2005-05-05, released 2006-02-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.222
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H3
    Database cross-references and differences (RAF-indexed):
    • GB CAA51455
      • engineered (110)
      • engineered (117)
    Domains in SCOPe 2.06: d1zlaa_
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zlab_
  • Chain 'C':
    Compound: Xenopus laevis-like histone H2A
    Species: Expression vector pET3-H2A [TaxId:263730]
    Gene: HISTONE H2A
    Database cross-references and differences (RAF-indexed):
    • GB CAD89676
      • engineered (68-69)
    Domains in SCOPe 2.06: d1zlac1
  • Chain 'D':
    Compound: histone h2b
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2B
    Database cross-references and differences (RAF-indexed):
    • GB CAA50512
    Domains in SCOPe 2.06: d1zlad_
  • Chain 'E':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H3
    Database cross-references and differences (RAF-indexed):
    • GB CAA51455 (Start-134)
      • engineered (110)
      • engineered (117)
    Domains in SCOPe 2.06: d1zlae_
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zlaf_
  • Chain 'G':
    Compound: Xenopus laevis-like histone H2A
    Species: Expression vector pET3-H2A [TaxId:263730]
    Gene: HISTONE H2A
    Database cross-references and differences (RAF-indexed):
    • GB CAD89676
      • engineered (68-69)
    Domains in SCOPe 2.06: d1zlag_
  • Chain 'H':
    Compound: histone h2b
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2B
    Database cross-references and differences (RAF-indexed):
    • GB CAA50512 (Start-124)
    Domains in SCOPe 2.06: d1zlah_
  • Chain 'I':
    Compound: Palindromic 146bp Human Alpha-Satellite DNA fragment
    Species: Homo sapiens [TaxId:9606]
    Gene: Alpha-Satellite DNA
  • Chain 'J':
    Compound: Palindromic 146bp Human Alpha-Satellite DNA fragment
    Species: Homo sapiens [TaxId:9606]
    Gene: Alpha-Satellite DNA
  • Chain 'K':
    Compound: latent nuclear antigen
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAD46501
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zlaA (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvhim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlaA (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvhimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zlaB (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlaB (B:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zlaC (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnwerdnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    esskstksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlaC (C:)
    aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnwerdn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zlaD (D:)
    pdpaksapaakkgskkavtktqkkdgkkrrksrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlaD (D:)
    rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
    eiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zlaE (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvhim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlaE (E:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvhimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1zlaF (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlaF (F:)
    rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
    ktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1zlaG (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnwerdnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    esskstksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlaG (G:)
    aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnwerdn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1zlaH (H:)
    pdpaksapaakkgskkavtktqkkdgkkrrksrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlaH (H:)
    rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
    eiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.