PDB entry 1zl8

View 1zl8 on RCSB PDB site
Description: NMR structure of L27 heterodimer from C. elegans Lin-7 and H. sapiens Lin-2 scaffold proteins
Class: protein binding
Keywords: heterodimer, L27, alpha helix, scaffold, assembly, specificity, signaling, PROTEIN BINDING
Deposited on 2005-05-05, released 2005-09-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lin-7
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: LIN7
    Database cross-references and differences (RAF-indexed):
    • GB AAB36684 (3-52)
      • cloning artifact (0-2)
    Domains in SCOPe 2.06: d1zl8a1, d1zl8a2
  • Chain 'B':
    Compound: Peripheral plasma membrane protein CASK
    Species: Homo sapiens [TaxId:9606]
    Gene: CASK, LIN2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zl8b1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zl8A (A:)
gslnlerdvqrilelmehvqktgevnnaklaslqqvlqseffgavrevyetvy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zl8B (B:)
sdavqrakevleeiscypenndakelkriltqphfmallqthdvvahevysdea