PDB entry 1zl8

View 1zl8 on RCSB PDB site
Description: NMR structure of L27 heterodimer from C. elegans Lin-7 and H. sapiens Lin-2 scaffold proteins
Class: protein binding
Keywords: heterodimer, L27, alpha helix, scaffold, assembly, specificity, signaling
Deposited on 2005-05-05, released 2005-09-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-14, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lin-7
  Species: Caenorhabditis elegans
  Gene: LIN7
  Database cross-references and differences (RAF-indexed):
  • GB AAB36684 (3-52)
    • cloning artifact (0-2)
  Domains in SCOP 1.73: d1zl8a1
• Chain 'B':
  Compound: Peripheral plasma membrane protein CASK
  Species: HOMO SAPIENS
  Gene: CASK, LIN2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14936 (0-53)
  Domains in SCOP 1.73: d1zl8b1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zl8A (A:)
  gslnlerdvqrilelmehvqktgevnnaklaslqqvlqseffgavrevyetvy
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zl8B (B:)
  sdavqrakevleeiscypenndakelkriltqphfmallqthdvvahevysdea