PDB entry 1zl7

View 1zl7 on RCSB PDB site
Description: Crystal structure of catalytically-active phospholipase A2 with bound calcium
Class: hydrolase
Keywords: Asp49-PLA2, snake venom
Deposited on 2005-05-05, released 2006-04-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.179
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypotensive phospholipase A2
  Species: Bothrops jararacussu
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8AXY1 (0-121)
    • conflict (57)
    • conflict (78)
  Domains in SCOP 1.73: d1zl7a1
• Heterogens: CA, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zl7A (A:)
  slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcnpk
  idsytyskkngdvvcggdnpckkqicecdrvattcfrdnkdtydikywfygakncqekse
  pc