PDB entry 1zl7

View 1zl7 on RCSB PDB site
Description: Crystal structure of catalytically-active phospholipase A2 with bound calcium
Class: hydrolase
Keywords: Asp49-PLA2, snake venom, hydrolase
Deposited on 2005-05-05, released 2006-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypotensive phospholipase A2
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AXY1 (0-121)
      • conflict (57)
      • conflict (78)
    Domains in SCOPe 2.08: d1zl7a_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zl7A (A:)
    slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcnpk
    idsytyskkngdvvcggdnpckkqicecdrvattcfrdnkdtydikywfygakncqekse
    pc