PDB entry 1zl3

View 1zl3 on RCSB PDB site
Description: Coupling of active site motions and RNA binding
Class: lyase/RNA
Keywords: RNA-modification, inter-domain coupling, product release, LYASE/RNA COMPLEX
Deposited on 2005-05-05, released 2005-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.202
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA pseudouridine synthase B
    Species: Escherichia coli [TaxId:562]
    Gene: truB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60340
      • cloning artifact (21)
      • engineered (60)
    Domains in SCOPe 2.08: d1zl3a1, d1zl3a2, d1zl3a3
  • Chain 'B':
    Compound: 5'-r(*gp*gp*cp*ap*ap*cp*gp*gp*up*(flo) up*cp*gp*ap*up*cp*cp*cp*gp*up*up*gp*c)-3'
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zl3A (A:)
    mghhhhhhhhhhssghiegrhmdingvllldkpqgmssndalqkvkriynanraghtgal
    nplatgmlpiclgeatkfsqylldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeq
    laaaldtfrgdieqipsmysalkyqgkklyeyarqgievprearpitvyellfirhegne
    leleihcskgtyirtiiddlgeklgcgahviylrrlavskypvermvtlehlrelveqae
    qqdipaaelldpllmpmdspasdypvvnlpltssvyfkngnpvrtsgapleglvrvtege
    ngkfigmgeiddegrvaprrlvveypa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zl3A (A:)
    mdingvllldkpqgmssndalqkvkriynanraghtgalnplatgmlpiclgeatkfsqy
    lldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipsmysa
    lkyqgkklyeyarqgievprearpitvyellfirhegneleleihcskgtyirtiiddlg
    eklgcgahviylrrlavskypvermvtlehlrelveqaeqqdipaaelldpllmpmdspa
    sdypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrl
    vv
    

  • Chain 'B':
    No sequence available.