PDB entry 1zku

View 1zku on RCSB PDB site
Description: Fitting of the gp9 structure in the EM density of bacteriophage T4 extended tail
Class: Viral protein
Keywords: Structural protein, Viral protein
Deposited on 2005-05-04, released 2005-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: EM
Resolution: 15 Å
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkua1
  • Chain 'B':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkub1
  • Chain 'C':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkuc1
  • Chain 'D':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkud1
  • Chain 'E':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkue1
  • Chain 'F':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkuf1
  • Chain 'G':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkug1
  • Chain 'H':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkuh1
  • Chain 'I':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkui1
  • Chain 'J':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkuj1
  • Chain 'K':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkuk1
  • Chain 'L':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkul1
  • Chain 'M':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkum1
  • Chain 'N':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkun1
  • Chain 'O':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkuo1
  • Chain 'P':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkup1
  • Chain 'Q':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkuq1
  • Chain 'R':
    Compound: Baseplate structural protein Gp9
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zkur1
  • Heterogens: EPE

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuA (A:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuB (B:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuC (C:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuD (D:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuE (E:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuF (F:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuG (G:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuH (H:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuI (I:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuJ (J:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuK (K:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuL (L:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuM (M:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuN (N:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuO (O:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuP (P:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuQ (Q:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zkuR (R:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq