PDB entry 1zkr

View 1zkr on RCSB PDB site
Description: Crystal structure of the major cat allergen Fel d 1 (1+2)
Class: allergen
Keywords: cat allergen, uteroglobin, secretoglobin
Deposited on 2005-05-04, released 2006-05-16
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.192
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major allergen I polypeptide, fused chain 1, chain 2
    Species: Felis silvestris catus
    Gene: CH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot 163827 (1-70)
      • cloning artifact (0)
    Domains in SCOP 1.73: d1zkra1, d1zkra2
  • Chain 'B':
    Compound: Major allergen I polypeptide, fused chain 1, chain 2
    Species: Felis silvestris catus
    Gene: CH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot 163827 (1-70)
      • cloning artifact (0)
    Domains in SCOP 1.73: d1zkrb1, d1zkrb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zkrA (A:)
    meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
    lldkiytsplcvkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcy
    venglisrvldglvmttissskdcmgehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkrA (A:)
    meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
    lldkiytsplcvkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcy
    venglisrvldglvmttissskdcmg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zkrB (B:)
    meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
    lldkiytsplcvkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcy
    venglisrvldglvmttissskdcmgehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkrB (B:)
    meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
    lldkiytsplcvkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcy
    venglisrvldglvmttissskdcm