PDB entry 1zkr

View 1zkr on RCSB PDB site
Description: Crystal structure of the major cat allergen Fel d 1 (1+2)
Class: allergen
Keywords: cat allergen, uteroglobin, secretoglobin, allergen
Deposited on 2005-05-04, released 2006-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.6400000000000001 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major allergen I polypeptide, fused chain 1, chain 2
    Species: Felis catus [TaxId:9685]
    Gene: CH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30438 (1-70)
      • initiating methionine (0)
      • conflict (60)
    • Uniprot P30440 (71-End)
      • initiating methionine (0)
      • conflict (60)
    Domains in SCOPe 2.08: d1zkra1, d1zkra2
  • Chain 'B':
    Compound: Major allergen I polypeptide, fused chain 1, chain 2
    Species: Felis catus [TaxId:9685]
    Gene: CH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30438 (1-70)
      • initiating methionine (0)
      • conflict (60)
    • Uniprot P30440 (71-End)
      • initiating methionine (0)
      • conflict (60)
    Domains in SCOPe 2.08: d1zkrb1, d1zkrb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zkrA (A:)
    meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
    lldkiytsplcvkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcy
    venglisrvldglvmttissskdcmgehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkrA (A:)
    meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
    lldkiytsplcvkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcy
    venglisrvldglvmttissskdcmg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zkrB (B:)
    meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
    lldkiytsplcvkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcy
    venglisrvldglvmttissskdcmgehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkrB (B:)
    meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
    lldkiytsplcvkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcy
    venglisrvldglvmttissskdcm