PDB entry 1zkl

View 1zkl on RCSB PDB site
Description: Multiple Determinants for Inhibitor Selectivity of Cyclic Nucleotide Phosphodiesterases
Class: hydrolase
Keywords: pde, hydrolase
Deposited on 2005-05-03, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.194
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High-affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE7A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zkla_
  • Heterogens: ZN, MG, IBM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zklA (A:)
    snslnildddyngqakcmlekvgnwnfdiflfdrltngnslvsltfhlfslhglieyfhl
    dmmklrrflvmiqedyhsqnpyhnavhaadvtqamhcylkepklansvtpwdillsliaa
    athdldhpgvnqpfliktnhylatlykntsvlenhhwrsavgllresglfshlplesrqq
    metqigalilatdisrqneylslfrshldrgdlcledtrhrhlvlqmalkcadicnpcrt
    welskqwsekvteeffhqgdiekkyhlgvsplcdrhtesianiqigfmtylveplftewa
    rfsntrlsqtmlghvglnkaswkglqreqsssedtdaafelnsqllpqenrls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zklA (A:)
    dyngqakcmlekvgnwnfdiflfdrltngnslvsltfhlfslhglieyfhldmmklrrfl
    vmiqedyhsqnpyhnavhaadvtqamhcylkepklansvtpwdillsliaaathdldhpg
    vnqpfliktnhylatlykntsvlenhhwrsavgllresglfshlplesrqqmetqigali
    latdisrqneylslfrshldrgdlcledtrhrhlvlqmalkcadicnpcrtwelskqwse
    kvteeffhqgdiekkyhlgvsplcdrhtesianiqigfmtylveplftewarfsntrlsq
    tmlghvglnkaswkglq