PDB entry 1zki

View 1zki on RCSB PDB site
Description: Structure of conserved protein PA5202 from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: Pseudomonas aeruginosa, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-05-02, released 2005-06-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.162
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA5202
    Species: Pseudomonas aeruginosa
    Gene: PA5202
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTY7 (Start-130)
      • modified residue (5)
      • modified residue (11)
      • modified residue (37)
      • modified residue (48)
      • modified residue (57)
      • modified residue (61)
    Domains in SCOP 1.73: d1zkia1
  • Chain 'B':
    Compound: hypothetical protein PA5202
    Species: Pseudomonas aeruginosa
    Gene: PA5202
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTY7 (Start-130)
      • modified residue (11)
      • modified residue (37)
      • modified residue (48)
      • modified residue (57)
      • modified residue (61)
    Domains in SCOP 1.73: d1zkib1
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zkiA (A:)
    ngmsempareqmisayselvgldpvslgdgvaevrlpmaahlrnrggvmhggalfslmdv
    tmglacssshgfdrqsvtleckinyiravadgevrcvarvlhagrrslvveaevrqgdkl
    vakgqgtfaqlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkiA (A:)
    mpareqmisayselvgldpvslgdgvaevrlpmaahlrnrggvmhggalfslmdvtmgla
    cssshgfdrqsvtleckinyiravadgevrcvarvlhagrrslvveaevrqgdklvakgq
    gtfaql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zkiB (B:)
    ngmsempareqmisayselvgldpvslgdgvaevrlpmaahlrnrggvmhggalfslmdv
    tmglacssshgfdrqsvtleckinyiravadgevrcvarvlhagrrslvveaevrqgdkl
    vakgqgtfaqlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkiB (B:)
    pareqmisayselvgldpvslgdgvaevrlpmaahlrnrggvmhggalfslmdvtmglac
    ssshgfdrqsvtleckinyiravadgevrcvarvlhagrrslvveaevrqgdklvakgqg
    tfaql