PDB entry 1zkg

View 1zkg on RCSB PDB site
Description: Crystal structure of Transcriptional regulator, TETR family (tm1030) from Thermotoga maritima at 2.30 A resolution
Class: transcription regulator
Keywords: tm1030, Transcriptional regulator, TETR family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, TRANSCRIPTION REGULATOR
Deposited on 2005-05-02, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TRANSCRIPTIONAL REGULATOR, TetR FAMILY
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm1030
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0C0 (12-211)
      • see remark 999 (12)
      • modified residue (67)
      • modified residue (82)
      • modified residue (93)
      • modified residue (166)
      • modified residue (191)
      • modified residue (201)
      • modified residue (209)
    Domains in SCOPe 2.06: d1zkga1, d1zkga2
  • Chain 'B':
    Compound: TRANSCRIPTIONAL REGULATOR, TetR FAMILY
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm1030
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0C0 (Start-211)
      • modified residue (67)
      • modified residue (82)
      • modified residue (93)
      • modified residue (166)
      • modified residue (191)
      • modified residue (201)
      • modified residue (209)
    Domains in SCOPe 2.06: d1zkgb1, d1zkgb2
  • Heterogens: UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zkgA (A:)
    mgsdkihhhhhhvlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknke
    elyyqaymsvteklqkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvs
    vdeglrkrilldleksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrt
    yqgkpellkrdmntlveevkvmlrilkkgmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkgA (A:)
    vlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvte
    klqkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilld
    leksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdm
    ntlveevkvmlrilkkgmtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zkgB (B:)
    mgsdkihhhhhhvlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknke
    elyyqaymsvteklqkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvs
    vdeglrkrilldleksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrt
    yqgkpellkrdmntlveevkvmlrilkkgmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkgB (B:)
    lskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvtek
    lqkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldl
    eksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmn
    tlveevkvmlrilkkgmtk