PDB entry 1zkd

View 1zkd on RCSB PDB site
Description: X-Ray structure of the putative protein Q6N1P6 from Rhodopseudomonas palustris at the resolution 2.1 A , Northeast Structural Genomics Consortium target RpR58
Class: structural genomics, unknown function
Keywords: NESG, RpR58, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-05-02, released 2005-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: duf185
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: RPA4359
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N1P6
      • modified residue (20)
      • modified residue (26)
      • modified residue (59)
      • modified residue (93-94)
      • modified residue (316)
      • modified residue (342)
      • modified residue (345)
    Domains in SCOPe 2.07: d1zkda1
  • Chain 'B':
    Compound: duf185
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: RPA4359
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N1P6
      • modified residue (20)
      • modified residue (26)
      • modified residue (59)
      • modified residue (93-94)
      • modified residue (316)
      • modified residue (342)
      • modified residue (345)
    Domains in SCOPe 2.07: d1zkdb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zkdA (A:)
    midqtalateikrlikaagpmpvwrymelclghpehgyyvtrdplgregdfttspeisqm
    fgellglwsasvwkaadepqtlrlieigpgrgtmmadalralrvlpilyqslsvhlvein
    pvlrqkqqtllagirnihwhdsfedvpegpavilaneyfdvlpihqaikretgwhervie
    igasgelvfgvaadpipgfeallpplarlsppgavfewrpdteilkiasrvrdqggaali
    idyghlrsdvgdtfqaiashsyadplqhpgradltahvdfdalgraaesigarahgpvtq
    gaflkrlgietralslmakatpqvsediagalqrltgegrgamgsmfkvigvsdpkietl
    valsddtdreaerrqgthglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkdA (A:)
    idqtalateikrlikaagpmpvwrymelclghpehgyyvtrfttspeisqmfgellglws
    asvwkaadepqtlrlieigpgrgtmmadalralrvlpilyqslsvhlveinpvlrqkqqt
    llagirnihwhdsfedvpegpavilaneyfdvlpihqaikretgwhervieigasgelvf
    gvaadpipgfeallpplarlsppgavfewrpdteilkiasrvrdqggaaliidyghlrsd
    vgdtfqaiashsyadplqhpgradltahvdfdalgraaesigarahgpvtqgaflkrlgi
    etralslmakatpqvsediagalqrltgegrgamgsmfkvigvsdpkietlvalsdd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zkdB (B:)
    midqtalateikrlikaagpmpvwrymelclghpehgyyvtrdplgregdfttspeisqm
    fgellglwsasvwkaadepqtlrlieigpgrgtmmadalralrvlpilyqslsvhlvein
    pvlrqkqqtllagirnihwhdsfedvpegpavilaneyfdvlpihqaikretgwhervie
    igasgelvfgvaadpipgfeallpplarlsppgavfewrpdteilkiasrvrdqggaali
    idyghlrsdvgdtfqaiashsyadplqhpgradltahvdfdalgraaesigarahgpvtq
    gaflkrlgietralslmakatpqvsediagalqrltgegrgamgsmfkvigvsdpkietl
    valsddtdreaerrqgthglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkdB (B:)
    idqtalateikrlikaagpmpvwrymelclghpehgyyvtfttspeisqmfgellglwsa
    svwkaadepqtlrlieigpgrgtmmadalralrvlpilyqslsvhlveinpvlrqkqqtl
    lagirnihwhdsfedvpegpavilaneyfdvlpihqaikretgwhervieigasgelvfg
    vaadpipgfeallpplarlsppgavfewrpdteilkiasrvrdqggaaliidyghlrsdv
    gdtfqaiashsyadplqhpgradltahvdfdalgraaesigarahgpvtqgaflkrlgie
    tralslmakatpqvsediagalqrltgegrgamgsmfkvigvsdpkietlvalsdd