PDB entry 1zk5

View 1zk5 on RCSB PDB site
Description: Escherichia coli F17fG lectin domain complex with N-acetylglucosamine
Class: cell adhesion
Keywords: lectin, beta sandwich, protein-structure complex, immunoglobulin-like fold, CELL ADHESION
Deposited on 2005-05-02, released 2006-05-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.185
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: f17g adhesin subunit
    Species: Escherichia coli [TaxId:562]
    Gene: 377F17G
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1zk5a_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zk5A (A:)
    avsfigstendvgpsqgsyssthamdnlpfvyntghnigyqnanvwrisggfcvgldgkv
    dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
    svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zk5A (A:)
    avsfigstendvgpsqgsyssthnlpfvyntghnigyqnanvwrisggfcvgldgkvdlp
    vvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqglsvh
    vrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlnd