PDB entry 1zk0

View 1zk0 on RCSB PDB site
Description: Structure of R-specific alcohol dehydrogenase (mutant G37D) from Lactobacillus brevis in complex with phenylethanol and NADH
Class: oxidoreductase
Keywords: short chain reductases/dehydrogenases, magnesium dependence, R-specific alcohol dehydrogenase, OXIDOREDUCTASE
Deposited on 2005-05-02, released 2005-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.143
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: R-specific alcohol dehydrogenase
    Species: LACTOBACILLUS BREVIS [TaxId:1580]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84EX5 (0-250)
      • engineered (36)
    Domains in SCOPe 2.08: d1zk0a_
  • Heterogens: MG, SS2, NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zk0A (A:)
    snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq