PDB entry 1zjw

View 1zjw on RCSB PDB site
Description: Glutaminyl-tRNA synthetase complexed to glutamine and 2'deoxy A76 glutamine tRNA
Class: ligase/RNA
Keywords: Protein-RNA complex, LIGASE/RNA COMPLEX
Deposited on 2005-05-01, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaminyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: glnS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zjwa1, d1zjwa2
  • Chain 'B':
    Compound: Glutaminyl-tRNA
    Species: synthetic, synthetic
  • Heterogens: SO4, AMP, GLN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zjwA (A:)
    seaearptnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgq
    cnlrfddtnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglay
    vdeltpeqireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmas
    pfivmrdpvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrly
    dwvldnitipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrg
    ytaasirefckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqgeg
    emvtmpnhpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvikae
    rvekdaegnittifctydadtlskdpadgrkvkgvihwvsaahalpveirlydrlfsvpn
    pgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsrhstaekpvfnr
    tvglrdtwakvge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zjwA (A:)
    tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
    tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
    qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
    pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
    tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
    efckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqgegemvtmpn
    hpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvikaervekdae
    gnittifctydadtlgvihwvsaahalpveirlydrlfsvpnpgaaddflsvinpeslvi
    kqgfaepslkdavagkafqferegyfcldsrhstaekpvfnrtvglrdt
    

  • Chain 'B':
    No sequence available.