PDB entry 1zjj

View 1zjj on RCSB PDB site
Description: Crystal structure of hypothetical protein PH1952 from Pyrococcus horikoshii OT3
Class: hydrolase
Keywords: alpha/beta hydrolase fold, had superfamily, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, HYDROLASE
Deposited on 2005-04-29, released 2006-04-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.195
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1952
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zjja_
  • Chain 'B':
    Compound: hypothetical protein PH1952
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zjjb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zjjA (A:)
    mvaiifdmdgvlyrgnraipgvrelieflkergipfafltnnstktpemyrekllkmgid
    vsssiiitsglatrlymskhldpgkifviggeglvkemqalgwgivtldearqgswkevk
    hvvvgldpdltyeklkyatlairngatfigtnpdatlpgeegiypgagsiiaalkvatnv
    epiiigkpnepmyevvremfpgeelwmvgdrldtdiafakkfgmkaimvltgvssledik
    kseykpdlvlpsvyelidylktl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zjjA (A:)
    mvaiifdmdgvlyrgnraipgvrelieflkergipfafltnnstktpemyrekllkmgid
    vsssiiitsglatrlymskhldpgkifviggeglvkemqalgwgivtldearqgswkevk
    hvvvgldpdltyeklkyatlairngatfigtnpdatlpgeegiypgagsiiaalkvatnv
    epiiigkpnepmyevvremfpgeelwmvgdrldtdiafakkfgmkaimvltgvssledik
    kseykpdlvlpsvyelidylk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zjjB (B:)
    mvaiifdmdgvlyrgnraipgvrelieflkergipfafltnnstktpemyrekllkmgid
    vsssiiitsglatrlymskhldpgkifviggeglvkemqalgwgivtldearqgswkevk
    hvvvgldpdltyeklkyatlairngatfigtnpdatlpgeegiypgagsiiaalkvatnv
    epiiigkpnepmyevvremfpgeelwmvgdrldtdiafakkfgmkaimvltgvssledik
    kseykpdlvlpsvyelidylktl