PDB entry 1zjd

View 1zjd on RCSB PDB site
Description: Crystal Structure of the Catalytic Domain of Coagulation Factor XI in Complex with Kunitz Protease Inhibitor Domain of Protease Nexin II
Class: hydrolase, blood clotting
Keywords: Coagulation Factor XI; Kunitz Protease Inhibitory Domain; Nexin II, HYDROLASE, BLOOD CLOTTING
Deposited on 2005-04-28, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Catalytic Domain of Coagulation Factor XI
  Species: Homo sapiens [TaxId:9606]
  Gene: F11
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03951 (0-236)
    • engineered (64)
    • engineered (105)
    • engineered (112)
  Domains in SCOPe 2.07: d1zjda1
• Chain 'B':
  Compound: Kunitz Protease Inhibitory Domain of Protease Nexin II
  Species: Homo sapiens [TaxId:9606]
  Gene: APP, A4, AD1F11
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (0-56)
  Domains in SCOPe 2.07: d1zjdb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zjdA (A:)
  ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
  ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdr
  nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
  kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zjdB (B:)
  evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcgsai