PDB entry 1zjd

View 1zjd on RCSB PDB site
Description: Crystal Structure of the Catalytic Domain of Coagulation Factor XI in Complex with Kunitz Protease Inhibitor Domain of Protease Nexin II
Class: hydrolase, blood clotting
Keywords: Coagulation Factor XI; Kunitz Protease Inhibitory Domain; Nexin II
Deposited on 2005-04-28, released 2005-08-09
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalytic Domain of Coagulation Factor XI
    Species: HOMO SAPIENS
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951 (0-236)
      • engineered (64)
      • engineered (105)
      • engineered (112)
  • Chain 'B':
    Compound: Kunitz Protease Inhibitory Domain of Protease Nexin II
    Species: HOMO SAPIENS
    Gene: APP, A4, AD1F11
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zjdb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zjdB (B:)
    evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcgsai