PDB entry 1zjc

View 1zjc on RCSB PDB site
Description: Aminopeptidase S from S. aureus
Class: hydrolase
Keywords: aminopeptidase, metallopeptidase, HYDROLASE
Deposited on 2005-04-28, released 2005-06-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminopeptidase ampS
    Species: Staphylococcus aureus subsp. aureus [TaxId:196620]
    Gene: AmpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zjca1
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zjcA (A:)
    gshmtnykeklqqyaellvkvgmnvqpkqpvfirssvetlelthliveeayhcgasdvrv
    vysdptlkrlkfenesvehfanheiksydvearmdyvkrgaanlalisedpdlmdgidsq
    klqafqqqnarafkgymesvqknqfpwvvaafpskawakrvypelsveeayikfidevfd
    ivridgndpvenwrqhianlsvyaqklqqknyhalhyvsegtdltvglaknhiwedatsy
    vngkeqafianipteevftapdrnrvdgyvtnklplsyngtiidqfklmfkdgeiidfsa
    ekgeavlkdlintdegsrrlgevalvpddspisnrntifyntlfdenaachlaigsayaf
    niqggtemtveekiasglndsnvhvdfmigssdltiygifedgskelvfengnwastf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zjcA (A:)
    nykeklqqyaellvkvgmnvqpkqpvfirssvetlelthliveeayhcgasdvrvvysdp
    tlkrlkfenesvehfanheiksydvearmdyvkrgaanlalisedpdlmdgidsqklqaf
    qqqnarafkgymesvqknqfpwvvaafpskawakrvypelsveeayikfidevfdivrid
    gndpvenwrqhianlsvyaqklqqknyhalhyvsegtdltvglaknhiwedatsyvngke
    qafianipteevftapdrnrvdgyvtnklplsyngtiidqfklmfkdgeiidfsaekgea
    vlkdlintdegsrrlgevalvpddspisnrntifyntlfdenaachlaigsayafniqgg
    temtveekiasglndsnvhvdfmigssdltiygifedgskelvfengnwastf