PDB entry 1zja

View 1zja on RCSB PDB site
Description: Crystal structure of the trehalulose synthase MutB from Pseudomonas mesoacidophila MX-45 (triclinic form)
Class: isomerase
Keywords: trehalulose synthase, sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel
Deposited on 2005-04-28, released 2006-10-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.184
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trehalulose synthase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1zjaa1, d1zjaa2
  • Chain 'B':
    Compound: Trehalulose synthase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1zjab1, d1zjab2
  • Heterogens: CA, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zjaA (A:)
    kpgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspnt
    dngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskd
    npyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklre
    elyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemh
    ekvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtla
    dfrqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgt
    pfifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartp
    fqwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgs
    yrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaag
    aaslelqpwqsgiykvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zjaB (B:)
    kpgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspnt
    dngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskd
    npyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklre
    elyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemh
    ekvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtla
    dfrqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgt
    pfifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartp
    fqwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgs
    yrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaag
    aaslelqpwqsgiykvk