PDB entry 1zj8

View 1zj8 on RCSB PDB site
Description: Structure of Mycobacterium tuberculosis NirA protein
Class: oxidoreductase
Keywords: NIRA, SULFITE, NITRITE, REDUCTASE, SIROHEME, FE4-S4, CYS-TYR COVALENT BOND, Structural Proteomics in Europe, SPINE, Structural Genomics
Deposited on 2005-04-28, released 2005-05-31
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.219
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ferredoxin-dependent nitrite reductase NirA
    Species: Mycobacterium tuberculosis
    Gene: NIRA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zj8a1, d1zj8a2, d1zj8a3, d1zj8a4
  • Chain 'B':
    Compound: Probable ferredoxin-dependent nitrite reductase NirA
    Species: Mycobacterium tuberculosis
    Gene: NIRA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zj8b1, d1zj8b2, d1zj8b3, d1zj8b4
  • Heterogens: CL, SF4, SRM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zj8A (A:)
    mdvshhhhhhgmatarpakarnegqwalghreplnaneelkkagnpldvrerieniyakq
    gfdsidktdlrgrfrwwglytqreqgydgtwtgddnidkleakyfmmrvrcdggalsaaa
    lrtlgqistefardtadisdrqnvqyhwievenvpeiwrrlddvglqtteacgdcprvvl
    gsplagesldevldptwaieeivrryigkpdfadlprkyktaisglqdvaheindvafig
    vnhpehgpgldlwvggglstnpmlaqrvgawvplgevpevwaavtsvfrdygyrrlraka
    rlkflikdwgiakfrevleteylkrplidgpapepvkhpidhvgvqrlknglnavgvapi
    agrvsgtiltavadlmaragsdrirftpyqklvildipdallddliagldalglqsrpsh
    wrrnlmacsgiefcklsfaetrvraqhlvpelerrledinsqldvpitvningcpnscar
    iqiadigfkgqmiddghggsvegfqvhlgghlgldagfgrklrqhkvtsdelgdyidrvv
    rnfvkhrsegerfaqwviraeeddlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zj8A (A:)
    rnegqwalghreplnaneelkkagnpldvrerieniyakqgfdsidktdlrgrfrwwgly
    tqreqgydgtwtgddnidkleakyfmmrvrcdggalsaaalrtlgqistefardtadisd
    rqnvqyhwievenvpeiwrrlddvglqtteacgdcprvvlgsplagesldevldptwaie
    eivrryigkpdfadlprkyktaisglqdvaheindvafigvnhpehgpgldlwvggglst
    npmlaqrvgawvplgevpevwaavtsvfrdygyrrlrakarlkflikdwgiakfrevlet
    eylkrplidgpapepvkhpidhvgvqrlknglnavgvapiagrvsgtiltavadlmarag
    sdrirftpyqklvildipdallddliagldalglqsrpshwrrnlmacsgiefcklsfae
    trvraqhlvpelerrledinsqldvpitvningcpnscariqiadigfkgqmiddghggs
    vegfqvhlgghlgldagfgrklrqhkvtsdelgdyidrvvrnfvkhrsegerfaqwvira
    eeddlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zj8B (B:)
    mdvshhhhhhgmatarpakarnegqwalghreplnaneelkkagnpldvrerieniyakq
    gfdsidktdlrgrfrwwglytqreqgydgtwtgddnidkleakyfmmrvrcdggalsaaa
    lrtlgqistefardtadisdrqnvqyhwievenvpeiwrrlddvglqtteacgdcprvvl
    gsplagesldevldptwaieeivrryigkpdfadlprkyktaisglqdvaheindvafig
    vnhpehgpgldlwvggglstnpmlaqrvgawvplgevpevwaavtsvfrdygyrrlraka
    rlkflikdwgiakfrevleteylkrplidgpapepvkhpidhvgvqrlknglnavgvapi
    agrvsgtiltavadlmaragsdrirftpyqklvildipdallddliagldalglqsrpsh
    wrrnlmacsgiefcklsfaetrvraqhlvpelerrledinsqldvpitvningcpnscar
    iqiadigfkgqmiddghggsvegfqvhlgghlgldagfgrklrqhkvtsdelgdyidrvv
    rnfvkhrsegerfaqwviraeeddlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zj8B (B:)
    rnegqwalghreplnaneelkkagnpldvrerieniyakqgfdsidktdlrgrfrwwgly
    tqreqgydgtwtgddnidkleakyfmmrvrcdggalsaaalrtlgqistefardtadisd
    rqnvqyhwievenvpeiwrrlddvglqtteacgdcprvvlgsplagesldevldptwaie
    eivrryigkpdfadlprkyktaisglqdvaheindvafigvnhpehgpgldlwvggglst
    npmlaqrvgawvplgevpevwaavtsvfrdygyrrlrakarlkflikdwgiakfrevlet
    eylkrplidgpapepvkhpidhvgvqrlknglnavgvapiagrvsgtiltavadlmarag
    sdrirftpyqklvildipdallddliagldalglqsrpshwrrnlmacsgiefcklsfae
    trvraqhlvpelerrledinsqldvpitvningcpnscariqiadigfkgqmiddghggs
    vegfqvhlgghlgldagfgrklrqhkvtsdelgdyidrvvrnfvkhrsegerfaqwvira
    eeddlr