PDB entry 1zj3

View 1zj3 on RCSB PDB site
Description: Crystal Structure of Human Galactosyltransferase (GTB) Complexed with H type II Trisaccharide
Class: Transferase
Keywords: GTB, ABO(H), H-antigen, Blood group, Transferase, retaining
Deposited on 2005-04-28, released 2005-12-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.204
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16442 (2-End)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d1zj3a1
  • Heterogens: HG, CL, DR2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zj3A (A:)
    fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
    aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrw
    qdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssr
    eaftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwh
    deshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zj3A (A:)
    fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
    aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvleverrfls
    evdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegd
    fyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspe
    ylwdqqllgwpavlrklrftavp