PDB entry 1zis

View 1zis on RCSB PDB site
Description: Recombinant Lumazine synthase (hexagonal form)
Class: transferase
Keywords: transferase
Deposited on 2005-04-27, released 2006-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.206
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zisa_
  • Chain 'B':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zisb_
  • Chain 'C':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zisc_
  • Chain 'D':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zisd_
  • Chain 'E':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zise_
  • Chain 'F':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zisf_
  • Chain 'G':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zisg_
  • Chain 'H':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zish_
  • Chain 'I':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zisi_
  • Chain 'J':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zisj_
  • Heterogens: PO4, INI

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zisA (A:)
    mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
    faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
    ieqaieragtkagnkgvdcavsaiemanlnrsfe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zisB (B:)
    mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
    faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
    ieqaieragtkagnkgvdcavsaiemanlnrsfe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zisC (C:)
    mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
    faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
    ieqaieragtkagnkgvdcavsaiemanlnrsfe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zisD (D:)
    mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
    faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
    ieqaieragtkagnkgvdcavsaiemanlnrsfe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zisE (E:)
    mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
    faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
    ieqaieragtkagnkgvdcavsaiemanlnrsfe
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zisF (F:)
    mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
    faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
    ieqaieragtkagnkgvdcavsaiemanlnrsfe
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zisG (G:)
    mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
    faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
    ieqaieragtkagnkgvdcavsaiemanlnrsfe
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zisH (H:)
    mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
    faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
    ieqaieragtkagnkgvdcavsaiemanlnrsfe
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zisI (I:)
    mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
    faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
    ieqaieragtkagnkgvdcavsaiemanlnrsfe
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zisJ (J:)
    mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
    faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
    ieqaieragtkagnkgvdcavsaiemanlnrsfe