PDB entry 1ziq

View 1ziq on RCSB PDB site
Description: Deuterated gammaE crystallin in D2O solvent
Class: structural protein
Keywords: 4 Greek key motifs, STRUCTURAL PROTEIN
Deposited on 2005-04-27, released 2005-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma crystallin E
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ziqa1, d1ziqa2
  • Heterogens: ACT, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ziqA (A:)
    gkitfyedrgfqgrhyecstdhsnlqpyfsrcnsvrvdsgcwmlyeqpnftgcqyflrrg
    dypdyqqwmgfsdsvrscrliphssshririyeredyrgqmveitddcphlqdrfhfsdf
    hsfhvmegywvlyempnyrgrqyllrpgeyrryhdwgamnarvgslrrimdfy