PDB entry 1zip

View 1zip on RCSB PDB site
Description: bacillus stearothermophilus adenylate kinase
Class: phosphotransferase
Keywords: phosphotransferase, kinase, ATP-binding
Deposited on 1997-05-07, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.156
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zipa1, d1zipa2
  • Heterogens: ZN, MN, AP5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zipA (A:)
mnlvlmglpgagkgtqaekivaaygiphistgdmfraamkegtplglqakqymdrgdlvp
devtigivrerlskddcqngflldgfprtvaqaealetmladigrkldyvihidvrqdvl
merltgrricrncgatyhlifhppakpgvcdkcggelyqraddneatvanrlevnmkqmk
plvdfyeqkgylrningeqdmekvfadirellgglar