PDB entry 1zip

View 1zip on RCSB PDB site
Description: bacillus stearothermophilus adenylate kinase
Class: phosphotransferase
Keywords: phosphotransferase, kinase, ATP-binding
Deposited on 1997-05-07, released 1997-08-20
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.156
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Bacillus stearothermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zipa1, d1zipa2
  • Heterogens: ZN, MN, AP5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zipA (A:)
    mnlvlmglpgagkgtqaekivaaygiphistgdmfraamkegtplglqakqymdrgdlvp
    devtigivrerlskddcqngflldgfprtvaqaealetmladigrkldyvihidvrqdvl
    merltgrricrncgatyhlifhppakpgvcdkcggelyqraddneatvanrlevnmkqmk
    plvdfyeqkgylrningeqdmekvfadirellgglar