PDB entry 1zio

View 1zio on RCSB PDB site
Description: phosphotransferase
Class: transferase
Keywords: phosphotransferase, zinc finger, kinase, transferase
Deposited on 1996-06-07, released 1997-07-07
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.161
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Bacillus stearothermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zioa1, d1zioa2
  • Heterogens: ZN, MG, AP5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zioA (A:)
    mnlvlmglpgagkgtqaekivaaygiphistgdmfraamkegtplglqakqymdrgdlvp
    devtigivrerlskddcqngflldgfprtvaqaealetmladigrkldyvihidvrqdvl
    merltgrricrncgatyhlifhppakpgvcdkcggelyqraddneatvanrlevnmkqmk
    plvdfyeqkgylrningeqdmekvfadirellgglar