PDB entry 1zin

View 1zin on RCSB PDB site
Description: adenylate kinase with bound ap5a
Class: phosphotransferase
Keywords: phosphotransferase, zinc finger
Deposited on 1996-06-07, released 1997-06-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zina1, d1zina2
  • Heterogens: ZN, AP5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zinA (A:)
mnlvlmglpgagkgtqaekivaaygiphistgdmfraamkegtplglqakqymdrgdlvp
devtigivrerlskddcqngflldgfprtvaqaealetmladigrkldyvihidvrqdvl
merltgrricrncgatyhlifhppakpgvcdkcggelyqraddneatvanrlevnmkqmk
plvdfyeqkgylrningeqdmekvfadirellgglar