PDB entry 1zii

View 1zii on RCSB PDB site
Description: gcn4-leucine zipper core mutant asn16aba in the dimeric state
Class: leucine zipper
Keywords: leucine zipper, amino-acid biosynthesis, transcription regulation, activator, DNA-binding, nuclear protein, coiled coil
Deposited on 1996-10-30, released 1997-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General control protein GCN4
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-End)
    • modified residue (15)
  Domains in SCOPe 2.08: d1ziia_
• Chain 'B':
  Compound: General control protein GCN4
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-End)
    • modified residue (15)
  Domains in SCOPe 2.08: d1ziib_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1ziiA (A:)
  rmkqledkveellskayhlenevarlkklvger
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ziiA (A:)
  rmkqledkveellskayhlenevarlkklvg
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1ziiB (B:)
  rmkqledkveellskayhlenevarlkklvger
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ziiB (B:)
  rmkqledkveellskayhlenevarlkklvg