PDB entry 1zie

View 1zie on RCSB PDB site
Description: Hydrogenated gammaE crystallin in D2O solvent
Class: structural protein
Keywords: 4 Greek key motifs, STRUCTURAL PROTEIN
Deposited on 2005-04-27, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.174
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma crystallin E
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ziea1, d1ziea2
  • Heterogens: ACT, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zieA (A:)
    gkitfyedrgfqgrhyecstdhsnlqpyfsrcnsvrvdsgcwmlyeqpnftgcqyflrrg
    dypdyqqwmgfsdsvrscrliphssshririyeredyrgqmveitddcphlqdrfhfsdf
    hsfhvmegywvlyempnyrgrqyllrpgeyrryhdwgamnarvgslrrimdfy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zieA (A:)
    gkitfyedrgfqgrhyecstdhsnlqpyfsrcnsvrvdsgcwmlyeqpnftgcqyflrrg
    dypdyqqwmgfsdsvrscrliphssshririyeredyrgqmveitddcphlqdrfhfsdf
    hsfhvmegywvlyempnyrgrqyllrpgeyrryhdwgamnarvgslrrimdf