PDB entry 1zib

View 1zib on RCSB PDB site
Description: reduced pseudoazurin
Deposited on 1996-04-09, released 1997-04-01
The last revision prior to the SCOP 1.55 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1687
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1zib__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zib_ (-)
    adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn