PDB entry 1zhv

View 1zhv on RCSB PDB site
Description: X-ray Crystal Structure Protein Atu0741 from Agobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR8.
Class: structural genomics, unknown function
Keywords: NESG, AtR8, Atu0741, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2005-04-26, released 2005-05-10
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.241
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Atu0741
    Species: Agrobacterium tumefaciens
    Gene: AGR_C_1340, Atu0741
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UHE1 (0-125)
      • cloning artifact (126-133)
    Domains in SCOP 1.73: d1zhva1, d1zhva2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zhvA (A:)
    apriklkilngsygiarlsaseaipawadgggfvsitrtddelsivclidripqdvrvdp
    gwscfkfqgpfafdetgivlsvisplstngigifvvstfdgdhllvrsndlektadllan
    aghslllehhhhhh