PDB entry 1zhv

View 1zhv on RCSB PDB site
Description: X-ray Crystal Structure Protein Atu0741 from Agobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR8.
Class: structural genomics, unknown function
Keywords: NESG, AtR8, Atu0741, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-04-26, released 2005-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein Atu0741
  Species: Agrobacterium tumefaciens [TaxId:176299]
  Gene: AGR_C_1340, Atu0741
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8UHE1 (0-125)
    • cloning artifact (126-133)
  Domains in SCOPe 2.08: d1zhva1, d1zhva2, d1zhva3
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zhvA (A:)
  apriklkilngsygiarlsaseaipawadgggfvsitrtddelsivclidripqdvrvdp
  gwscfkfqgpfafdetgivlsvisplstngigifvvstfdgdhllvrsndlektadllan
  aghslllehhhhhh