PDB entry 1zhm

View 1zhm on RCSB PDB site
Description: Crystal Structure of the Catalytic Domain of the Coagulation Factor XIa in Complex with Benzamidine (S434A-T475A-K437 Mutant)
Class: hydrolase, blood clotting
Keywords: Factor XI; benzamidine, HYDROLASE, BLOOD CLOTTING
Deposited on 2005-04-26, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.17
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coagulation factor XI
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951 (0-236)
      • engineered (64)
      • engineered (67)
      • engineered (105)
    Domains in SCOPe 2.07: d1zhma_
  • Heterogens: BEN, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zhmA (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zhmA (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa