PDB entry 1zhi

View 1zhi on RCSB PDB site
Description: Complex of the S. cerevisiae Orc1 and Sir1 interacting domains
Class: Transcription/Replication
Keywords: protein complex, BAH domain, OIR domain, Transcription-Replication COMPLEX
Deposited on 2005-04-25, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Origin recognition complex subunit 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Orc1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zhia_
  • Chain 'B':
    Compound: Regulatory protein SIR1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21691 (Start-137)
      • engineered (119)
    Domains in SCOPe 2.08: d1zhib1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zhiA (A:)
    gshmasmaktlkdlqgweiittdeqgniidggqkrlrrrgaktehylkrssdgiklgrgd
    svvmhneaagtysvymiqelrlntlnnvvelwaltylrwfevnplahyrqfnpdanilnr
    plnyynklfsetanknelyltaelaelqlfnfirvanvmdgskwevlkgnvdperdftvr
    yiceptgekfvdiniedvkayikkvepreaqeylkdltlpskkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zhiA (A:)
    gweiittdeqgniidggtehylkrssdgiklgrgdsvvmhneaagtysvymiqelrlntl
    nnvvelwaltylrwfevnplahyrqfnpdanilnrplnyynklfsetanknelyltaela
    elqlfnfirvanvmdgskwevlkgnvdperdftvryiceptgekfvdiniedvkayikkv
    epreaqeylkdltlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zhiB (B:)
    gshmasekkfsteeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmn
    lvkwndfkkyqdpiplkaktlfkfckqikkkflrgadfklhtlpteanlkyepermtvla
    scvpillddqtvqylydd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zhiB (B:)
    eeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkkyqdp
    iplkaktlfkfckqikkkflrgadfklhtlpteanlkyepermtvlascvpillddqtvq
    ylydd