PDB entry 1zhh

View 1zhh on RCSB PDB site
Description: Crystal Structure of the Apo Form of Vibrio Harveyi LUXP Complexed with the Periplasmic Domain of LUXQ
Class: Signaling Protein
Keywords: periplasmic binding protein, per/arnt/simple-minded (pas) fold, autoinducer-2 (ai-2), quorum sensing, sensor kinase
Deposited on 2005-04-25, released 2005-05-24
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-07, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autoinducer 2-binding periplasmic protein luxP
    Species: Vibrio harveyi
    Gene: luxP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zhha1
  • Chain 'B':
    Compound: Autoinducer 2 sensor kinase/phosphatase luxQ
    Species: Vibrio harveyi
    Gene: luxQ
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zhhA (A:)
    tqvlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdy
    wvrniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhr
    kfvehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyy
    svlyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfi
    yacstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamae
    aikwdledkpvptvysgdfeivtkadsperiealkkrafrysdn
    

  • Chain 'B':
    No sequence available.