PDB entry 1zhg

View 1zhg on RCSB PDB site
Description: Crystal structure of Beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Plasmodium falciparum
Class: lyase
Keywords: FabZ, Plasmodium falciparum, beta-hydroxyacyl acyl carrier protein dehydratase, hot dog fold
Deposited on 2005-04-25, released 2006-05-30
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.222
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta hydroxyacyl-acyl carrier protein dehydratase
    Species: Plasmodium falciparum
    Gene: FabZ
    Database cross-references and differences (RAF-indexed):
    • GB AAM75408 (Start-138)
    Domains in SCOP 1.75: d1zhga1
  • Chain 'B':
    Compound: beta hydroxyacyl-acyl carrier protein dehydratase
    Species: Plasmodium falciparum
    Gene: FabZ
    Database cross-references and differences (RAF-indexed):
    • GB AAM75408 (0-138)
    Domains in SCOP 1.75: d1zhgb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zhgA (A:)
    dikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlqieala
    qlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiaklsgv
    gyvngkvvinisemtfals
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zhgA (A:)
    kilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlqiealaqla
    gilclksddsnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiaklsgvgyvngk
    vvinisemtfals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zhgB (B:)
    dikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlqieala
    qlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiaklsgv
    gyvngkvvinisemtfals
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zhgB (B:)
    dikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlqieala
    qlagilclksnnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiaklsgvgyvng
    kvvinisemtfals