PDB entry 1zha

View 1zha on RCSB PDB site
Description: A. aeolicus KDO8PS R106G mutant in complex with PEP and R5P
Class: transferase
Keywords: KDSA KDO8PS loops catalysis conformations, TRANSFERASE
Deposited on 2005-04-25, released 2005-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: kdsA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66496
      • engineered (105)
    Domains in SCOPe 2.07: d1zhaa_
  • Chain 'B':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: kdsA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66496
      • engineered (105)
    Domains in SCOPe 2.07: d1zhab_
  • Heterogens: R5P, CD, PEP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zhaA (A:)
    mekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgl
    eygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcgqtdlllaaaktgra
    vnvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakvi
    ydathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpl
    sqlegiieaileirevaskyyetipvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zhaA (A:)
    ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
    ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcgqtdlllaaaktgrav
    nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
    dathsvqlpggmrefifpliraavavgcdgvfmethpepekalsdastqlplsqlegiie
    aileirevaskyyeti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zhaB (B:)
    mekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgl
    eygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcgqtdlllaaaktgra
    vnvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakvi
    ydathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpl
    sqlegiieaileirevaskyyetipvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zhaB (B:)
    kflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgley
    gvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcgqtdlllaaaktgravn
    vkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviyd
    athsvqlpggmrefifpliraavavgcdgvfmethpepekalsdastqlplsqlegiiea
    ileirevaskyyeti