PDB entry 1zh8

View 1zh8 on RCSB PDB site
Description: Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution
Class: oxidoreductase
Keywords: TM0312, oxidoreductase (EC 1.1.1.-), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, OXIDOREDUCTASE
Deposited on 2005-04-22, released 2005-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.196
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0312
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYE8 (Start-339)
      • modified residue (63)
      • modified residue (165)
      • modified residue (173)
      • modified residue (206)
      • modified residue (230)
      • modified residue (282)
    Domains in SCOPe 2.08: d1zh8a1, d1zh8a2
  • Chain 'B':
    Compound: Oxidoreductase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0312
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYE8 (Start-339)
      • modified residue (63)
      • modified residue (165)
      • modified residue (173)
      • modified residue (206)
      • modified residue (230)
      • modified residue (282)
    Domains in SCOPe 2.08: d1zh8b1, d1zh8b2
  • Heterogens: NA, NAP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zh8A (A:)
    mgsdkihhhhhhmkplrkirlgivgcgiaarelhlpalknlshlfeitavtsrtrshaee
    fakmvgnpavfdsyeellesglvdavdltlpvelnlpfiekalrkgvhvicekpistdve
    tgkkvvelseksektvyiaenfrhvpafwkakelvesgaigdpvfmnwqiwvgmdennky
    vhtdwrkkpkhvggflsdggvhhaaamrlilgeiewisavakdlspllggmdflssifef
    engtvgnytisyslkgnerfeitgtkgkisiswdkivlneeemkvpqensyqkefedfyq
    vvaegkpndlgspvqalkdlafieacvrsagnkvfvssll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zh8A (A:)
    lrkirlgivgcgiaarelhlpalknlshlfeitavtsrtrshaeefakmvgnpavfdsye
    ellesglvdavdltlpvelnlpfiekalrkgvhvicekpistdvetgkkvvelseksekt
    vyiaenfrhvpafwkakelvesgaigdpvfmnwqiwvgmdennkyvhtdwrkkpkhvggf
    lsdggvhhaaamrlilgeiewisavakdlspllggmdflssifefengtvgnytisyslk
    gnerfeitgtkgkisiswdkivlneeemkvpqensyqkefedfyqvvaegkpndlgspvq
    alkdlafieacvrsagnkvfvssll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zh8B (B:)
    mgsdkihhhhhhmkplrkirlgivgcgiaarelhlpalknlshlfeitavtsrtrshaee
    fakmvgnpavfdsyeellesglvdavdltlpvelnlpfiekalrkgvhvicekpistdve
    tgkkvvelseksektvyiaenfrhvpafwkakelvesgaigdpvfmnwqiwvgmdennky
    vhtdwrkkpkhvggflsdggvhhaaamrlilgeiewisavakdlspllggmdflssifef
    engtvgnytisyslkgnerfeitgtkgkisiswdkivlneeemkvpqensyqkefedfyq
    vvaegkpndlgspvqalkdlafieacvrsagnkvfvssll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zh8B (B:)
    rkirlgivgcgiaarelhlpalknlshlfeitavtsrtrshaeefakmvgnpavfdsyee
    llesglvdavdltlpvelnlpfiekalrkgvhvicekpistdvetgkkvvelseksektv
    yiaenfrhvpafwkakelvesgaigdpvfmnwqiwvgmdennkyvhtdwrkkpkhvggfl
    sdggvhhaaamrlilgeiewisavakdlspllggmdflssifefengtvgnytisyslkg
    nerfeitgtkgkisiswdkivlneeemkvpqensyqkefedfyqvvaegkpndlgspvqa
    lkdlafieacvrsagnkvfvssll