PDB entry 1zgv

View 1zgv on RCSB PDB site
Description: Thrombin in complex with an oxazolopyridine inhibitor 2
Class: hydrolase/hydrolase inhibitor
Keywords: thrombin, thrombin inhibitor complex, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2005-04-22, released 2005-09-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zgva_
  • Chain 'B':
    Compound: hirudin
    Species: Hirudo medicinalis, synthetic [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 501, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zgvA (A:)
    dcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcgas
    lisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpryn
    wrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwtan
    vgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvm
    kspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zgvA (A:)
    dcglrplfekksledkterellesyiivegsdaeigmspwqvmlfrkspqellcgaslis
    drwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynwre
    nldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlkegqpsvlqv
    vnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqm
    givswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

  • Chain 'B':
    No sequence available.