PDB entry 1zgu

View 1zgu on RCSB PDB site
Description: Solution structure of the human Mms2-Ubiquitin complex
Class: ligase/signaling protein
Keywords: UEV domain, ubiquitin binding motif, LIGASE/SIGNALING PROTEIN COMPLEX
Deposited on 2005-04-22, released 2006-04-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2V2, MMS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1zgua1
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61864 (0-75)
      • see remark 999 (18)
      • see remark 999 (23)
      • see remark 999 (27)
      • engineered (47)
    Domains in SCOPe 2.03: d1zgub1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zguA (A:)
    vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
    vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
    mskenmklpqppegqtynn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zguB (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
    iqkestlhlvlrlrgg