PDB entry 1zgu
View 1zgu on RCSB PDB site
Description: Solution structure of the human Mms2-Ubiquitin complex
Class: ligase/signaling protein
Keywords: UEV domain, ubiquitin binding motif, LIGASE/SIGNALING PROTEIN COMPLEX
Deposited on
2005-04-22, released
2006-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ubiquitin-conjugating enzyme E2 variant 2
Species: Homo sapiens [TaxId:9606]
Gene: UBE2V2, MMS2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1zgua_ - Chain 'B':
Compound: Ubiquitin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P61864 (0-75)
- see remark 999 (18)
- see remark 999 (23)
- see remark 999 (27)
- engineered (47)
Domains in SCOPe 2.08: d1zgub1
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1zguA (A:)
vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
mskenmklpqppegqtynn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1zguB (B:)
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
iqkestlhlvlrlrgg