PDB entry 1zgt

View 1zgt on RCSB PDB site
Description: Structure of hydrogenated rat gamma E crystallin in H2O
Class: structural protein
Keywords: 4 Greek Key motifs, STRUCTURAL PROTEIN
Deposited on 2005-04-22, released 2005-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.209
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma crystallin E
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zgta1, d1zgta2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zgtA (A:)
gkitfyedrgfqgrhyecstdhsnlqpyfsrcnsvrvdsgcwmlyeqpnftgcqyflrrg
dypdyqqwmgfsdsvrscrliphssshririyeredyrgqmveitddcphlqdrfhfsdf
hsfhvmegywvlyempnyrgrqyllrpgeyrryhdwgamnarvgslrrimdfy