PDB entry 1zgk

View 1zgk on RCSB PDB site
Description: 1.35 angstrom structure of the Kelch domain of Keap1
Class: protein binding
Keywords: beta-propeller, kelch repeat motif, protein binding
Deposited on 2005-04-21, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.112
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KEAP1, KIAA0132
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14145 (Start-307)
      • modified residue (97)
      • modified residue (107)
      • modified residue (154)
      • modified residue (197)
      • modified residue (201)
      • modified residue (248)
      • modified residue (295)
    Domains in SCOPe 2.07: d1zgka1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zgkA (A:)
    gsshhhhhhssglvprgshapkvgrliytaggyfrqslsyleaynpsngtwlrladlqvp
    rsglagcvvggllyavggrnnspdgntdssaldcynpmtnqwspcapmsvprnrigvgvi
    dghiyavggshgcihhnsveryeperdewhlvapmltrrigvgvavlnrllyavggfdgt
    nrlnsaecyypernewrmitamntirsgagvcvlhnciyaaggydgqdqlnsverydvet
    etwtfvapmkhrrsalgitvhqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgr
    sgvgvavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zgkA (A:)
    pkvgrliytaggyfrqslsyleaynpsngtwlrladlqvprsglagcvvggllyavggrn
    nspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsve
    ryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmit
    amntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitv
    hqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt