PDB entry 1zgh

View 1zgh on RCSB PDB site
Description: Methionyl-tRNA formyltransferase from Clostridium thermocellum
Class: transferase
Keywords: Methionyl-tRNA formyltransferase, Southeast Collaboratory for Structural Genomics, Clostridium thermocellum, PSI, Protein Structure Initiative, SECSG, Transferase
Deposited on 2005-04-21, released 2005-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA formyltransferase
    Species: Clostridium thermocellum [TaxId:203119]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00313263 (30-End)
      • cloning artifact (29)
      • modified residue (30)
      • modified residue (104)
      • modified residue (160)
      • modified residue (170)
      • modified residue (216)
      • modified residue (241)
    Domains in SCOPe 2.08: d1zgha1, d1zgha2, d1zgha3
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zghA (A:)
    mgsshhhhhhssglvprgsqstslykkaglmniiiattkswniknaqkfkkeneskyntt
    iitnkdeltfekvklinpeyilfphwswiipkeifenftcvvfhmtdlpfgrggsplqnl
    iergikktkisaikvdggidtgdiffkrdldlygtaeeifmraskiifndmipelltkrp
    vpqkqegeatvfqrrkpeqseispdfdlekiydyirmldgegyprafikygkyrlefsra
    smkngkiiadveiiegdene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zghA (A:)
    lmniiiattkswniknaqkfkkeneskynttiitnkdeltfekvklinpeyilfphwswi
    ipkeifenftcvvfhmtdlpfgrggsplqnliergikktkisaikvdggidtgdiffkrd
    ldlygtaeeifmraskiifndmipelltkrpvpqkqegeatvfqrrkpeqseispdfdle
    kiydyirmldgegyprafikygkyrlefsrasmkngkiiadveiieg