PDB entry 1zg8

View 1zg8 on RCSB PDB site
Description: Crystal Structure of (R)-2-(3-{[amino(imino)methyl]amino}phenyl)-3-sulfanylpropanoic acid Bound to Activated Porcine Pancreatic Carboxypeptidase B
Class: hydrolase
Keywords: carboxypeptidase b, exopeptidase, thiol based inhibitor, hydrolase
Deposited on 2005-04-20, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Procarboxypeptidase B
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zg8a_
  • Chain 'B':
    Compound: Procarboxypeptidase B
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zg8b_
  • Chain 'C':
    Compound: Procarboxypeptidase B
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zg8c_
  • Heterogens: ZN, L98, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zg8A (A:)
    ttghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaif
    mdcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtkn
    rmwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfi
    rnnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygp
    gattiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtn
    yvlghl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zg8A (A:)
    tghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifm
    dcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknr
    mwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfir
    nnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpg
    attiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtny
    vlghl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zg8B (B:)
    ttghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaif
    mdcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtkn
    rmwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfi
    rnnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygp
    gattiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtn
    yvlghl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zg8B (B:)
    tghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifm
    dcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknr
    mwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfir
    nnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpg
    attiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtny
    vlghl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zg8C (C:)
    ttghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaif
    mdcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtkn
    rmwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfi
    rnnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygp
    gattiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtn
    yvlghl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zg8C (C:)
    ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
    cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
    wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
    nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
    ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
    lghl