PDB entry 1zg1

View 1zg1 on RCSB PDB site
Description: NarL complexed to nirB promoter non-palindromic tail-to-tail DNA site
Class: transcription/DNA
Keywords: protein-DNA complex, helix-turn-helix, two-component response regulator, dna bending, TRANSCRIPTION/DNA COMPLEX
Deposited on 2005-04-20, released 2005-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.257
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrate/nitrite response regulator protein narl
    Species: Escherichia coli [TaxId:562]
    Gene: narL, frdR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AF28 (Start-81)
      • modified residue (40)
      • modified residue (59)
      • modified residue (63)
    Domains in SCOPe 2.07: d1zg1a1
  • Chain 'B':
    Compound: nitrate/nitrite response regulator protein narl
    Species: Escherichia coli [TaxId:562]
    Gene: narL, frdR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AF28 (Start-81)
      • modified residue (40)
      • modified residue (59)
      • modified residue (63)
    Domains in SCOPe 2.07: d1zg1b1
  • Chain 'C':
    Compound: 5'-d(*cp*gp*tp*ap*cp*tp*cp*cp*tp*tp*ap*ap*tp*gp*gp*gp*tp*ap*cp*g)-3'
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 5'-d(*cp*gp*tp*ap*cp*cp*cp*ap*tp*tp*ap*ap*gp*gp*ap*gp*tp*ap*cp*g)-3'
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: nitrate/nitrite response regulator protein narl
    Species: Escherichia coli [TaxId:562]
    Gene: narL, frdR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AF28 (Start-81)
      • modified residue (40)
      • modified residue (59)
      • modified residue (63)
    Domains in SCOPe 2.07: d1zg1e1
  • Chain 'F':
    Compound: nitrate/nitrite response regulator protein narl
    Species: Escherichia coli [TaxId:562]
    Gene: narL, frdR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AF28 (Start-81)
      • modified residue (40)
      • modified residue (59)
      • modified residue (63)
    Domains in SCOPe 2.07: d1zg1f1
  • Chain 'G':
    Compound: 5'-d(*cp*gp*tp*ap*cp*cp*cp*ap*tp*tp*ap*ap*gp*gp*ap*gp*tp*ap*cp*g)-3'
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: 5'-d(*cp*gp*tp*ap*cp*tp*cp*cp*tp*tp*ap*ap*tp*gp*gp*gp*tp*ap*cp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zg1A (A:)
    mrgshhhhhhgsatterdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhm
    lkkmklksrveaavwvhqerif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zg1A (A:)
    rdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwv
    hqerif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zg1B (B:)
    mrgshhhhhhgsatterdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhm
    lkkmklksrveaavwvhqerif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zg1B (B:)
    rdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwv
    hqerif
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zg1E (E:)
    mrgshhhhhhgsatterdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhm
    lkkmklksrveaavwvhqerif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zg1E (E:)
    rdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwv
    hqerif
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1zg1F (F:)
    mrgshhhhhhgsatterdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhm
    lkkmklksrveaavwvhqerif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zg1F (F:)
    rdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwv
    hqerif
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.