PDB entry 1zfs

View 1zfs on RCSB PDB site
Description: Solution structure of S100A1 bound to calcium
Class: metal binding protein
Keywords: S100, noncovalent homodimer, x-type 4 helix bundle, calcium binding, conformational change, METAL BINDING PROTEIN
Deposited on 2005-04-20, released 2006-04-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-100 protein, alpha chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100a1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zfsa1
  • Chain 'B':
    Compound: S-100 protein, alpha chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100a1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zfsb1
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zfsA (A:)
    gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
    ldengdgevdfqefvvlvaaltvacnnffwens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zfsB (B:)
    gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
    ldengdgevdfqefvvlvaaltvacnnffwens