PDB entry 1zfs
View 1zfs on RCSB PDB site
Description: Solution structure of S100A1 bound to calcium
Class: metal binding protein
Keywords: S100, noncovalent homodimer, x-type 4 helix bundle, calcium binding, conformational change, METAL BINDING PROTEIN
Deposited on
2005-04-20, released
2006-04-11
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: S-100 protein, alpha chain
Species: Rattus norvegicus [TaxId:10116]
Gene: S100a1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1zfsa1 - Chain 'B':
Compound: S-100 protein, alpha chain
Species: Rattus norvegicus [TaxId:10116]
Gene: S100a1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1zfsb1 - Heterogens: CA
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1zfsA (A:)
gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
ldengdgevdfqefvvlvaaltvacnnffwens
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1zfsB (B:)
gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
ldengdgevdfqefvvlvaaltvacnnffwens